PDB entry 1utt

View 1utt on RCSB PDB site
Description: crystal structure of mmp-12 complexed to 2-(1,3-dioxo-1,3-dihydro-2h- isoindol-2-yl)ethyl-4-(4-ethoxy[1,1-biphenyl]-4-yl)-4-oxobutanoic acid
Deposited on 2003-12-10, released 2004-12-15
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-15, with a file datestamp of 2004-12-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1utta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uttA (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslygd