SCOPe 2.06: Structural Classification of Proteins

PDB entry 1ut2

View 1ut2 on RCSB PDB site
Description: afae-3 adhesin from escherichia coli
Class: adhesin
Keywords: adhesin, afae-3, afimbrial adhesin, upec, daec
Deposited on 2003-12-02, released 2004-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.228
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-End)
Domains in SCOPe 2.06: d1ut2a_
Chain 'B':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-End)
Domains in SCOPe 2.06: d1ut2b_
Chain 'C':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-End)
Domains in SCOPe 2.06: d1ut2c_
Chain 'D':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-End)
Domains in SCOPe 2.06: d1ut2d_
Chain 'E':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-End)
Domains in SCOPe 2.06: d1ut2e_
Chain 'F':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-End)
Domains in SCOPe 2.06: d1ut2f_
Chain 'G':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-End)
Domains in SCOPe 2.06: d1ut2g_
Chain 'H':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-148)
Domains in SCOPe 2.06: d1ut2h_
Chain 'I':
Compound: afimbrial adhesin afa-III
Species: ESCHERICHIA COLI [TaxId:562]
Database cross-references and differences (RAF-indexed):
- PDB 1UT2
  - engineered mutation (9-10)
- Uniprot Q57254 (9-End)
Domains in SCOPe 2.06: d1ut2i_
Heterogens: SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1ut2A (A:)
rgshhhhhhgsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalg
cnarqvalkadtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswgg
tigiyvdgqqtntppgnytltltggywak