PDB entry 1usv

View 1usv on RCSB PDB site
Description: the structure of the complex between aha1 and hsp90
Deposited on 2003-12-01, released 2004-01-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-29, with a file datestamp of 2004-01-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1usva_
  • Chain 'B':
    Domains in SCOP 1.71: d1usvb_
  • Chain 'C':
    Domains in SCOP 1.71: d1usvc_
  • Chain 'D':
    Domains in SCOP 1.71: d1usvd_
  • Chain 'E':
    Domains in SCOP 1.71: d1usve_
  • Chain 'F':
    Domains in SCOP 1.71: d1usvf_
  • Chain 'G':
    Domains in SCOP 1.71: d1usvg_
  • Chain 'H':
    Domains in SCOP 1.71: d1usvh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1usvA (A:)
    gktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfd
    lfeskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimk
    virknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstks
    vdeltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaf
    tqlkefegktlvditkdfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usvA (A:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
    kknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvirkni
    vkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdelts
    ltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkef
    egktlvditkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1usvB (B:)
    mrgshhhhhhgmasmvvnnpnnwhwvdkncigwakeyfkqklvgveagsvkdkkyakiks
    vssiegdcevnqrkgkvislfdlkitvlieghvdskdgsalpfegsinvpevafdseass
    yqfdisifketselseakplirsellpklrqifqqfgkdllathgndiqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usvB (B:)
    wvdkncigwakeyfkqklvgveagsvkdkkyakiksvssiegdcevnqrkgkvislfdlk
    itvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplirse
    llpklrqifqqfgkdllathgnd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1usvC (C:)
    gktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfd
    lfeskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimk
    virknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstks
    vdeltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaf
    tqlkefegktlvditkdfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usvC (C:)
    ktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdk
    knniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlmlqqnkimkvirknivkkl
    ieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltdy
    vtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefegkt
    lvditkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1usvD (D:)
    mrgshhhhhhgmasmvvnnpnnwhwvdkncigwakeyfkqklvgveagsvkdkkyakiks
    vssiegdcevnqrkgkvislfdlkitvlieghvdskdgsalpfegsinvpevafdseass
    yqfdisifketselseakplirsellpklrqifqqfgkdllathgndiqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usvD (D:)
    wvdkncigwakeyfkqklvgveagsvkdkkyakiksvssiegdcevnqrkgkvislfdlk
    itvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplirse
    llpklrqifqqfgkdllathgn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1usvE (E:)
    gktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfd
    lfeskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimk
    virknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstks
    vdeltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaf
    tqlkefegktlvditkdfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usvE (E:)
    ktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdl
    kknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvirkni
    vkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdelts
    ltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkef
    egktlvditkd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1usvF (F:)
    mrgshhhhhhgmasmvvnnpnnwhwvdkncigwakeyfkqklvgveagsvkdkkyakiks
    vssiegdcevnqrkgkvislfdlkitvlieghvdskdgsalpfegsinvpevafdseass
    yqfdisifketselseakplirsellpklrqifqqfgkdllathgndiqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usvF (F:)
    whwvdkncigwakeyfkqklvgveagsvkdkkyakiksvssiegdcevnqrkgkvislfd
    lkitvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplir
    sellpklrqifqqfgkdllathgndi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1usvG (G:)
    gktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfd
    lfeskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimk
    virknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstks
    vdeltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaf
    tqlkefegktlvditkdfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usvG (G:)
    ktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfkk
    nniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvirknivk
    klieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltslt
    dyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefeg
    ktlvditk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1usvH (H:)
    mrgshhhhhhgmasmvvnnpnnwhwvdkncigwakeyfkqklvgveagsvkdkkyakiks
    vssiegdcevnqrkgkvislfdlkitvlieghvdskdgsalpfegsinvpevafdseass
    yqfdisifketselseakplirsellpklrqifqqfgkdllathgndiqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usvH (H:)
    wvdkncigwakeyfkqklvgveagsvkdkkyakiksvssiegdcevnqrkgkvislfdlk
    itvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplirse
    llpklrqifqqfgkdllathg