PDB entry 1usu

View 1usu on RCSB PDB site
Description: the structure of the complex between aha1 and hsp90
Deposited on 2003-12-01, released 2004-01-29
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-29, with a file datestamp of 2004-01-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.213
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1usua_
  • Chain 'B':
    Domains in SCOP 1.67: d1usub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1usuA (A:)
    gptkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfd
    lfeskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimk
    virknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstks
    vdeltsltdyvtrmpehqkniyyitgeslksvekspfldalkaknfevlfltdpideyaf
    tqlkefegktlvditkdfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usuA (A:)
    ptkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdl
    fesnniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlqnkimkvirknivkkli
    eafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltdyv
    trmpehqkniyyitgeslksvekspfldalkaknfevlfltdpideyaftqlkefegktl
    vditkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1usuB (B:)
    mrgshhhhhhgmasmvvnnpnnwhwvdkncigwakeyfkqkivgveagsvkdkkyakiks
    vssiegdcevnqrkgkvislfdlkitvlieghvdskdgsalpfegsinvpevafdseass
    yqfdisifketselseakplirsellpklrqifqqfgkdllathgndiqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1usuB (B:)
    vdkncigwakeyfkqkivgveakkyakiksvssiegdcevnqrgkvislfdlkitvlieg
    hvdsalpfegsinvpevafdseassyqfdisifketselseakplirsellpklrqifqq
    fgkdllathgnd