PDB entry 1usi

View 1usi on RCSB PDB site
Description: l-leucine-binding protein with phenylalanine bound
Class: transport protein
Keywords: leucine-binding protein, x-ray crystallography, protein structure, abc transport systems, transport protein
Deposited on 2003-11-24, released 2003-12-18
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine-specific binding protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04816 (0-345)
      • conflict (343)
    Domains in SCOP 1.75: d1usia_
  • Chain 'C':
    Compound: leucine-specific binding protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04816 (0-345)
      • conflict (343)
    Domains in SCOP 1.75: d1usic_
  • Heterogens: PHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1usiA (A:)
    ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1usiC (C:)
    ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak