PDB entry 1usg

View 1usg on RCSB PDB site
Description: l-leucine-binding protein, apo form
Class: transport protein
Keywords: leucine-binding protein, x-ray crystallography, protein structure, abc transport systems, transport protein
Deposited on 2003-11-24, released 2003-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.191
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine-specific binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04816 (0-345)
      • conflict (343)
    Domains in SCOPe 2.06: d1usga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1usgA (A:)
    ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak