PDB entry 1us4

View 1us4 on RCSB PDB site
Description: putative glur0 ligand binding core with l-glutamate
Class: receptor
Keywords: receptor, membrane protein, glutamate receptor, glur0, l-glutamate, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2003-11-18, released 2003-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative glur0 ligand binding core
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1US4 (Start-313)
    Domains in SCOPe 2.07: d1us4a_
  • Heterogens: GLU, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1us4A (A:)
    mrkpilaaltlaglglaqefitigsgsttgvyfpvatgiaklvndanvgiranarstggs
    vaninainagefemalaqndiayyayqgccipafegkpvktiralaalypevvhvvarkd
    agirtvadlkgkrvvvgdvgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkr
    adalfytvglgasaiqqlalttpialvavdlnriqaiakkypfyvgfnipggtykgvdvt
    tptvavqamliaserlseetvykfmkavfgnleafkkihpnlerffglekavkglpiplh
    pgaerfykeagvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1us4A (A:)
    aqefitigsgsttgvyfpvatgiaklvndanvgiranarstggsvaninainagefemal
    aqndiayyayqgccipafegkpvktiralaalypevvhvvarkdagirtvadlkgkrvvv
    gdvgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkradalfytvglgasaiq
    qlalttpialvavdlnriqaiakkypfyvgfnipggtykgvdvttptvavqamliaserl
    seetvykfmkavfgnleafkkihpnlerffglekavkglpiplhpgaerfykeagvlk