PDB entry 1urn

View 1urn on RCSB PDB site
Description: u1a mutant/rna complex + glycerol
Deposited on 1995-01-04, released 1996-03-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1urna_
  • Chain 'B':
    Domains in SCOP 1.57: d1urnb_
  • Chain 'C':
    Domains in SCOP 1.57: d1urnc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urnA (A:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urnB (B:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urnC (C:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm