PDB entry 1url

View 1url on RCSB PDB site
Description: n-terminal domain of sialoadhesin (mouse) in complex with glycopeptide
Class: sugar binding protein/immune system
Keywords: lectin/ig-domain, sialoadhesin, oligosaccharide mimics, molecular mimicry, cell adhesion, lectin, immunoglobulin domain, sugar binding protein immune system complex, sugar binding protein, immune system, sugar binding protein/immune system complex
Deposited on 2003-10-31, released 2004-10-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialoadhesin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1urla_
  • Chain 'B':
    Compound: ala-gly-his-thr-trp-gly-hia
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1URL (Start-6)
  • Heterogens: SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urlA (A:)
    twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
    dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt
    

  • Chain 'B':
    No sequence available.