PDB entry 1ur5

View 1ur5 on RCSB PDB site
Description: stabilization of a tetrameric malate dehydrogenase by introduction of a disulfide bridge at the dimer/dimer interface
Deposited on 2003-10-27, released 2003-11-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-04, with a file datestamp of 2003-12-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ur5A (A:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemv
    plprfscisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur5A (A:)
    rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
    tnnyadtansdvivvtsgaedlikvnaditracisqaaplspnaviimvnnpldamtyla
    aevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemvplprfscis
    gipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmp
    vaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavratldtlks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ur5C (C:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemv
    plprfscisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur5C (C:)
    rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
    tnnyadtansdvivvtsgaredlikvnaditracisqaaplspnaviimvnnpldamtyl
    aaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemvplprfsci
    sgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvm
    pvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavratldtlks
    l