PDB entry 1upv

View 1upv on RCSB PDB site
Description: crystal structure of the human liver x receptor beta ligand binding domain in complex with a synthetic agonist
Class: receptor
Keywords: receptor, nuclear hormone receptor, ligand binding domain, liver x receptor, crystal structure, transcription factor
Deposited on 2003-10-13, released 2004-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPV
    • Uniprot P55055 (Start-256)
    Domains in SCOPe 2.07: d1upva_
  • Heterogens: 444, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upvA (A:)
    gshmsqgsgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdar
    qqrfahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhet
    ecitflkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrp
    nvqepgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrl
    qdkklppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upvA (A:)
    qltaaqelmiqqlvaaqlqvtpwplgadpqsrdarqqrfahftelaiisvqeivdfakqv
    pgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqvef
    inpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytri
    krpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdvhe