PDB entry 1unh

View 1unh on RCSB PDB site
Description: structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
Deposited on 2003-09-10, released 2004-11-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-10, with a file datestamp of 2004-11-10.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.22897
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1unha_
  • Chain 'B':
    Domains in SCOP 1.71: d1unhb_
  • Chain 'D':
    Domains in SCOP 1.71: d1unhd_
  • Chain 'E':
    Domains in SCOP 1.71: d1unhe_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1unhA (A:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unhA (A:)
    qkyeklekiygtvfkaknrheivalkrvrldgvpssalreicllkelkhknivrlhdvlh
    sdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkpqn
    llinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsagci
    faelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslvnv
    vpklnatgrdllqnllkcnpvqrisaeealqhpyfsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1unhB (B:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unhB (B:)
    qkyeklekiygtvfkaknrheivalkrvrldgvpssalreicllkelkhknivrlhdvlh
    sdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkpqn
    llinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsagci
    faelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslvnv
    vpklnatgrdllqnllkcnpvqrisaeealqhpyfsd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1unhD (D:)
    qpppaqppappasqlsgsqtggsssvkkaphpavtsagtpkrvivqastsellrclgefl
    crrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflymlcrdvissevgsd
    helqavlltclylsysymgneisyplkpflvesckeafwdrclsvinlmsskmlqinadp
    hyftqvfsdlknesgqedkkrlllgldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unhD (D:)
    stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
    lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
    lmsskmlqinadphyftqvfsdlknesg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1unhE (E:)
    qpppaqppappasqlsgsqtggsssvkkaphpavtsagtpkrvivqastsellrclgefl
    crrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflymlcrdvissevgsd
    helqavlltclylsysymgneisyplkpflvesckeafwdrclsvinlmsskmlqinadp
    hyftqvfsdlknesgqedkkrlllgldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1unhE (E:)
    stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
    lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
    lmsskmlqinadphyftqvfsdlknesg