PDB entry 1ung

View 1ung on RCSB PDB site
Description: structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
Class: cell cycle
Keywords: cell cycle, complex(kinase-activator), inhibitors, neurodegenerative diseases
Deposited on 2003-09-10, released 2004-11-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00535 (0-291)
      • engineered mutation (143)
    Domains in SCOPe 2.03: d1unga_
  • Chain 'B':
    Compound: cell division protein kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00535
      • engineered mutation (143)
    Domains in SCOPe 2.03: d1ungb_
  • Chain 'D':
    Compound: Cyclin-dependent kinase 5 activator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ungd_
  • Chain 'E':
    Compound: Cyclin-dependent kinase 5 activator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1unge_
  • Heterogens: ALH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ungA (A:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ungA (A:)
    mqkyeklekiygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhkniv
    rlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlh
    rdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklystsid
    mwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypa
    ttslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ungB (B:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ungB (B:)
    qkyeklektvfkaivalkrvrldgvpssalreicllkelkhknivrlhdvlhsdkkltlv
    fefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkpqnllinrnge
    lklanfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsagcifaelanag
    rplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslvnvvpklnatg
    rdllqnllkcnpvqrisaeealqhpyfsd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ungD (D:)
    qpppaqppappasqlsgsqtggsssvkkaphpavtsagtpkrvivqastsellrclgefl
    crrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflymlcrdvissevgsd
    helqavlltclylsysymgneisyplkpflvesckeafwdrclsvinlmsskmlqinadp
    hyftqvfsdlknesgqedkkrlllgldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ungD (D:)
    qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl
    ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv
    inlmsskmlqinadphyftqvfsdlknesg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ungE (E:)
    qpppaqppappasqlsgsqtggsssvkkaphpavtsagtpkrvivqastsellrclgefl
    crrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflymlcrdvissevgsd
    helqavlltclylsysymgneisyplkpflvesckeafwdrclsvinlmsskmlqinadp
    hyftqvfsdlknesgqedkkrlllgldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ungE (E:)
    stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
    lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
    lmsskmlqinadphyftqvfsdlknesg