PDB entry 1umk

View 1umk on RCSB PDB site
Description: The Structure of Human Erythrocyte NADH-cytochrome b5 Reductase
Class: oxidoreductase
Keywords: flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, OXIDOREDUCTASE
Deposited on 2003-10-03, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.167
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadh-cytochrome b5 reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1umka1, d1umka2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umkA (A:)
    fqrstpaitlespdikyplrlidreiishdtrrfrfalpspqhilglpvgqhiylsarid
    gnlvvrpytpissdddkgfvdlvikvyfkdthpkfpaggkmsqylesmqigdtiefrgps
    gllvyqgkgkfairpdkksnpiirtvksvgmiaggtgitpmlqviraimkdpddhtvchl
    lfanqtekdillrpeleelrnkhsarfklwytldrapeawdygqgfvneemirdhlpppe
    eeplvlmcgpppmiqyaclpnldhvghptercfvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umkA (A:)
    tpaitlespdikyplrlidreiishdtrrfrfalpspqhilglpvgqhiylsaridgnlv
    vrpytpissdddkgfvdlvikvyfkdthpkfpaggkmsqylesmqigdtiefrgpsgllv
    yqgkgkfairpdkksnpiirtvksvgmiaggtgitpmlqviraimkdpddhtvchllfan
    qtekdillrpeleelrnkhsarfklwytldrapeawdygqgfvneemirdhlpppeeepl
    vlmcgpppmiqyaclpnldhvghptercfvf