PDB entry 1um6

View 1um6 on RCSB PDB site
Description: catalytic antibody 21h3
Class: immune system
Keywords: catalytic antibody ligand transesterification, IMMUNE SYSTEM
Deposited on 2003-09-23, released 2004-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.231
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody 21h3, H chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UM6 (0-216)
    Domains in SCOPe 2.06: d1um6h1, d1um6h2
  • Chain 'L':
    Compound: antibody 21h3, L chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UM6 (0-218)
    Domains in SCOPe 2.06: d1um6l1, d1um6l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um6H (H:)
    vqlqqsgpvlvkpggsvkmsckaseytltsylfqwvkqksgqglewigyiypynggtryn
    ekfrgkatltsdkssntaylelssltsedsavyycarssmsdpganwgpgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um6L (L:)
    ldiqmtqspsslsaslgervsltcrasqeisgylywlqqkpdgtikrliyagstldsgvp
    krfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgecgaga