PDB entry 1um4

View 1um4 on RCSB PDB site
Description: Catalytic Antibody 21H3 with hapten
Class: immune system
Keywords: catalytic antibody ligand transesterification, IMMUNE SYSTEM
Deposited on 2003-09-23, released 2004-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody 21H3 H chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UM4 (0-216)
    Domains in SCOPe 2.06: d1um4h1, d1um4h2
  • Chain 'L':
    Compound: Antibody 21H3 L chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UM4 (0-218)
    Domains in SCOPe 2.06: d1um4l1, d1um4l2
  • Heterogens: SH4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um4H (H:)
    vqlqqsgpvlvkpggsvkmsckaseytltsylfqwvkqksgqglewigyiypynggtryn
    ekfrgkatltsdkssntaylelssltsedsavyycarssmsdpganwgpgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1um4L (L:)
    ldiqmtqspsslsaslgervsltcrasqeisgylywlqqkpdgtikrliyagstldsgvp
    krfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgecgaga