PDB entry 1ul7

View 1ul7 on RCSB PDB site
Description: Solution structure of kinase associated domain 1 of mouse MAP/microtubule affinity-regulating kinase 3
Class: transferase
Keywords: KA1 domain, ELKL motif, MARK3, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-09-10, released 2004-03-10
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-28, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MAP/microtubule affinity-regulating kinase 3
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 1600015G02, Mark3, Emk2, Mpk10
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03141 (7-101)
    • cloning artifact (0-6)
    • conflict (32)
  Domains in SCOP 1.73: d1ul7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ul7A (A:)
  gssgssgrftwsmkttssmdpsdmmreirkvlganncdyeqrerfllfcvhgdghaenlv
  qwemevcklprlslngvrfkrisgtsiafkniaskianelkl