PDB entry 1ujt

View 1ujt on RCSB PDB site
Description: Solution structure of the second fibronectin Type III domain of human KIAA1568 protein
Class: structural genomics, unknown function
Keywords: fibronectin type III domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-08-11, released 2004-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1568 Protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA fh22308
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HCK4 (7-113)
    • cloning artifact (0-6)
    • cloning artifact (114-119)
  Domains in SCOPe 2.06: d1ujta1, d1ujta2, d1ujta3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ujtA (A:)
  gssgssgrqvqkelgdvlvrlhnpvvltpttvqvtwtvdrqpqfiqgyrvmyrqtsglqa
  tsswqnldakvptersavlvnlkkgvtyeikvrpyfnefqgmdsesktvrtteesgpssg