PDB entry 1uiq

View 1uiq on RCSB PDB site
Description: Crystal Structure of Threonine Synthase from Thermus Thermophilus HB8 in complex with a substrate analogue
Class: lyase
Keywords: PLP-dependent enzyme
Deposited on 2003-07-17, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-12-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Thermus thermophilus
    Gene: HB8
    Domains in SCOPe 2.07: d1uiqa_
  • Chain 'B':
    Compound: threonine synthase
    Species: Thermus thermophilus
    Gene: HB8
    Domains in SCOPe 2.07: d1uiqb_
  • Chain 'C':
    Compound: threonine synthase
    Species: Thermus thermophilus
    Gene: HB8
    Domains in SCOPe 2.07: d1uiqc_
  • Chain 'D':
    Compound: threonine synthase
    Species: Thermus thermophilus
    Gene: HB8
    Domains in SCOPe 2.07: d1uiqd_
  • Heterogens: HEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uiqA (A:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uiqB (B:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uiqC (C:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uiqD (D:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll