PDB entry 1uin

View 1uin on RCSB PDB site
Description: Crystal Structure of Threonine Synthase from Thermus Thermophilus HB8, Trigonal Crystal Form
Class: lyase
Keywords: PLP-dependent enzyme, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2003-07-17, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uina_
  • Chain 'B':
    Compound: threonine synthase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uinb_
  • Heterogens: SO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uinA (A:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uinA (A:)
    rpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfk
    drgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqsl
    vhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphy
    halpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatai
    rignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkll
    regrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uinB (B:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uinB (B:)
    plieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfkdr
    gmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagvalgkvaqslvhg
    arivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphyhal
    pvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatairig
    npaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkllreg
    rlepestvvltltghglkdpataervaelpppvparleavaaaagl