PDB entry 1uim

View 1uim on RCSB PDB site
Description: Crystal Structure of Threonine Synthase from Thermus Thermophilus HB8, Orthorhombic Crystal Form
Class: lyase
Keywords: PLP-dependent enzyme, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2003-07-17, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uima_
  • Chain 'B':
    Compound: threonine synthase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uimb_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uimA (A:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uimA (A:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uimB (B:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uimB (B:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagl