PDB entry 1uij

View 1uij on RCSB PDB site
Description: Crystal Structure Of Soybean beta-Conglycinin Beta Homotrimer (I122M/K124W)
Class: sugar binding protein
Keywords: double-stranded beta helix, seed storage protein, SUGAR BINDING PROTEIN
Deposited on 2003-07-16, released 2004-07-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta subunit of beta conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25974
      • engineered (121)
      • engineered (123)
    Domains in SCOPe 2.01: d1uija1, d1uija2
  • Chain 'B':
    Compound: beta subunit of beta conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25974
      • engineered (121)
      • engineered (123)
    Domains in SCOPe 2.01: d1uijb1, d1uijb2
  • Chain 'C':
    Compound: beta subunit of beta conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25974
      • engineered (121)
      • engineered (123)
    Domains in SCOPe 2.01: d1uijc1, d1uijc2
  • Chain 'D':
    Compound: beta subunit of beta conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25974
      • engineered (121)
      • engineered (123)
    Domains in SCOPe 2.01: d1uijd1, d1uijd2
  • Chain 'E':
    Compound: beta subunit of beta conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25974
      • engineered (121)
      • engineered (123)
    Domains in SCOPe 2.01: d1uije1, d1uije2
  • Chain 'F':
    Compound: beta subunit of beta conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25974
      • engineered (121)
      • engineered (123)
    Domains in SCOPe 2.01: d1uijf1, d1uijf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uijA (A:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijA (A:)
    redennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntill
    phhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmi
    wlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeqrqq
    egvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpq
    lrdldiflssvdinegalllphfnskaivilvinegdanielvgiklevqryraelsedd
    vfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaq
    dverllkkqresyfvda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uijB (B:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijB (B:)
    redennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntill
    phhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmi
    wlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgqegvivel
    skeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldif
    lssvdinegalllphfnskaivilvinegdanielvgiklevqryraelseddvfvipaa
    ypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllk
    kqresyfvda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uijC (C:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijC (C:)
    dennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillph
    hadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmiwl
    aipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgqegvivelde
    pfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvdinegalllphfnskaivilv
    inegdanielvgikplevqryraelseddvfvipaaypfvvnatsnlnflafginaennq
    rnflagekdnvvrqierqvqelafpgsaqdverllkkqresyfvda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uijD (D:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijD (D:)
    redennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntill
    phhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmi
    wlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeqrqq
    egvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpq
    lrdldiflssvdinegalllphfnskaivilvinegdanielvgiklevqryraelsedd
    vfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaq
    dverllkkqresyfvda
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uijE (E:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijE (E:)
    redennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntill
    phhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmi
    wlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgqegvivel
    skeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldif
    lssvdinegalllphfnskaivilvinegdanielvgiklevqryraelseddvfvipaa
    ypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllk
    kqresyfvda
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uijF (F:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijF (F:)
    dennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillph
    hadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmiwl
    aipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgqegvivelde
    pfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvdinegalllphfnskaivilv
    inegdanielvgikplevqryraelseddvfvipaaypfvvnatsnlnflafginaennq
    rnflagekdnvvrqierqvqelafpgsaqdverllkkqresyfvda