PDB entry 1uif

View 1uif on RCSB PDB site
Description: analysis of the stabilization of hen lysozyme with the helix dipole and charged side chains
Deposited on 1996-11-26, released 1997-11-26
The last revision prior to the SCOP 1.59 freeze date was dated 1997-11-26, with a file datestamp of 1997-11-26.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1uif__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uif_ (-)
    kvfgrcelaaamkrvgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl