PDB entry 1uif

View 1uif on RCSB PDB site
Description: analysis of the stabilization of hen lysozyme with the helix dipole and charged side chains
Class: hydrolase
Keywords: hydrolase, glycosidase, electrostatic interaction, helix, hen lysozyme, stability
Deposited on 1996-11-26, released 1997-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.174
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Gallus gallus [TaxId:9031]
    Gene: HEN LYSOZYME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered (14)
    Domains in SCOPe 2.07: d1uifa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uifA (A:)
    kvfgrcelaaamkrvgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl