PDB entry 1ui8

View 1ui8 on RCSB PDB site
Description: Site-directed mutagenesis of His592 involved in binding of copper ion in Arthrobacter globiformis amine oxidase
Class: oxidoreductase
Keywords: oxidoreductase, copper, amine oxidase, quinone cofactor, TPQ, histidine, metal coordination
Deposited on 2003-07-15, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • modified residue (381)
      • engineered (591)
    Domains in SCOPe 2.07: d1ui8a1, d1ui8a2, d1ui8a3
  • Chain 'B':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • modified residue (381)
      • engineered (591)
    Domains in SCOPe 2.07: d1ui8b1, d1ui8b2, d1ui8b3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ui8A (A:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfgltafprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ui8A (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfgltafprvedwpimpvdtvg
    fklrpegffdrspvldvpan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ui8B (B:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfgltafprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ui8B (B:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfgltafprvedwpimpvdtvg
    fklrpegffdrspvldvpan