PDB entry 1uhv

View 1uhv on RCSB PDB site
Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase
Deposited on 2003-07-11, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhvA (A:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhvB (B:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhvC (C:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhvD (D:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy