PDB entry 1uho

View 1uho on RCSB PDB site
Description: Crystal structure of Human Phosphodiesterase 5 complexed with Vardenafil(Levitra)
Class: hydrolase
Keywords: PDE5 inhibitor complex, hydrolase
Deposited on 2003-07-09, released 2004-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uhoa_
  • Heterogens: ZN, MG, VDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uhoA (A:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlkii
    kqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqq
    riaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthvs
    edcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uhoA (A:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hrgvnnsyychsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlal
    yikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateff
    dqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthvsedcfplldgcr
    knrqkwqalaeqq