PDB entry 1uhn

View 1uhn on RCSB PDB site
Description: The crystal structure of the calcium binding protein AtCBL2 from Arabidopsis thaliana
Class: metal binding protein
Keywords: calcium binding protein, METAL BINDING PROTEIN
Deposited on 2003-07-07, released 2003-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcineurin B-like protein 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uhna_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uhnA (A:)
dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf
dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat
laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit
ttfpsfvfh