PDB entry 1uhb
View 1uhb on RCSB PDB site
Description: Crystal structure of porcine alpha trypsin bound with auto catalyticaly produced native peptide at 2.15 A resolution
Class: Hydrolase
Keywords: Serine Protease, Hydrolase, peptide trypsin complex
Deposited on
2003-06-27, released
2004-07-27
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.193
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Trypsin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1uhb.1 - Chain 'B':
Compound: Trypsin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1uhb.1 - Chain 'P':
Compound: 9-mer peptide from Trypsin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
- Heterogens: ACT, CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1uhbA (A:)
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1uhbB (B:)
ssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggpvvcng
qlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
- Chain 'P':
No sequence available.