PDB entry 1uhb

View 1uhb on RCSB PDB site
Description: Crystal structure of porcine alpha trypsin bound with auto catalyticaly produced native peptide at 2.15 A resolution
Class: Hydrolase
Keywords: Serine Protease, Hydrolase, peptide trypsin complex
Deposited on 2003-06-27, released 2004-07-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Trypsin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00761 (0-124)
  Domains in SCOPe 2.02: d1uhb.1
• Chain 'B':
  Compound: Trypsin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00761 (0-97)
  Domains in SCOPe 2.02: d1uhb.1
• Chain 'P':
  Compound: 9-mer peptide from Trypsin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00761 (0-8)
• Heterogens: ACT, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uhbA (A:)
  ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
  neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
  wgntk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uhbB (B:)
  ssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggpvvcng
  qlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
  

  
  
• Chain 'P':
  No sequence available.