PDB entry 1uge

View 1uge on RCSB PDB site
Description: human carbonic anhydrase II [hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by leu (a65l)
Class: lyase
Keywords: lyase, acetylation, zinc, polymorphism, disease mutation
Deposited on 1996-07-24, released 1997-04-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: HOMO SAPIENS
    Gene: CAII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-257)
      • engineered (62)
    Domains in SCOP 1.75: d1ugea_
  • Heterogens: HG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ugeA (A:)
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghlfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk