PDB entry 1ufw

View 1ufw on RCSB PDB site
Description: Solution structure of RNP domain in Synaptojanin 2
Class: RNA binding protein
Keywords: NMR, RNP domain, Synaptojanin 2, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA binding protein
Deposited on 2003-06-10, released 2003-12-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptojanin 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg01551
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15056 (7-88)
      • cloning artifact (0-6)
      • cloning artifact (89-94)
    Domains in SCOPe 2.06: d1ufwa1, d1ufwa2, d1ufwa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufwA (A:)
    gssgssgssfqgpldatvvvnlqsptleeknefpedlrtelmqtlgsygtivlvrinqgq
    mlvtfadshsalsvldvdgmkvkgravkisgpssg