PDB entry 1ufp

View 1ufp on RCSB PDB site
Description: Crystal Structure of an Artificial Metalloprotein:Fe(III)(3,3'-Me2-salophen)/apo-wild type Myoglobin
Class: oxygen storage/transport
Keywords: myoglobin, Schiff base, iron, salophen, metalloprotein
Deposited on 2003-06-04, released 2004-05-18
The last revision prior to the SCOP 1.73 freeze date was dated 2004-05-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • initiating met (0)
  Domains in SCOP 1.73: d1ufpa_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ufpA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgdfgadaqgamnkalelfrkdiaakykelgyqg