PDB entry 1uff

View 1uff on RCSB PDB site
Description: solution structure of the first sh3 domain of human intersectin2 (kiaa1256)
Deposited on 2003-05-29, released 2003-11-29
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-29, with a file datestamp of 2003-11-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uffa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uffA (A:)
    gssgssgyralypfearnhdemsfnsgdiiqvdektvgepgwlygsfqgnfgwfpcnyve
    kmpssenekavspkkallpptvslsatsgpssg