PDB entry 1uey

View 1uey on RCSB PDB site
Description: solution structure of the first fibronectin type iii domain of human kiaa0343 protein
Deposited on 2003-05-22, released 2003-11-22
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-22, with a file datestamp of 2003-11-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1ueya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ueyA (A:)
  gssgssgptpapvydvpnppfdleltdqldksvqlswtpgddnnspitkfiieyedamhk
  pglwhhqtevsgtqttaqlnlspyvnysfrvmavnsigkslpseaseqyltkasepdknp
  tsgpssg