PDB entry 1uel

View 1uel on RCSB PDB site
Description: Solution structure of ubiquitin-like domain of hHR23B complexed with ubiquitin-interacting motif of proteasome subunit S5a
Class: GENE REGULATION/protein binding
Keywords: UBL, UIM, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, GENE REGULATION/protein binding COMPLEX
Deposited on 2003-05-19, released 2004-02-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UV excision repair protein RAD23 homolog B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54727 (0-86)
      • expression tag (87-94)
    Domains in SCOPe 2.02: d1uela_
  • Chain 'B':
    Compound: 26S proteasome non-ATPase regulatory subunit 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55036 (3-47)
      • cloning artifact (0-2)
    Domains in SCOPe 2.02: d1uelb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uelA (A:)
mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk
eykideknfvvvmvtkpkavstpapatlehhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uelB (B:)
gshmtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad