PDB entry 1udk

View 1udk on RCSB PDB site
Description: Solution Structure of Nawaprin
Class: unknown function
Keywords: antiparallel beta-sheet, spiral backbone configuration, UNKNOWN FUNCTION
Deposited on 2003-05-01, released 2003-11-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nawaprin
    Species: Naja nigricollis [TaxId:8654]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UDK (0-50)
    Domains in SCOPe 2.02: d1udka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1udkA (A:)
    neksgscpdmsmpipplgicktlcnsdsgcpnvqkcckngcgfmtcttpvp