PDB entry 1udk

View 1udk on RCSB PDB site
Description: Solution Structure of Nawaprin
Class: unknown function
Keywords: antiparallel beta-sheet, spiral backbone configuration, UNKNOWN FUNCTION
Deposited on 2003-05-01, released 2003-11-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nawaprin
  Species: Naja nigricollis [TaxId:8654]
  Database cross-references and differences (RAF-indexed):
  • PDB 1UDK (0-50)
  Domains in SCOPe 2.01: d1udka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1udkA (A:)
  neksgscpdmsmpipplgicktlcnsdsgcpnvqkcckngcgfmtcttpvp