PDB entry 1udk

View 1udk on RCSB PDB site
Description: Solution Structure of Nawaprin
Class: unknown function
Keywords: antiparallel beta-sheet, spiral backbone configuration
Deposited on 2003-05-01, released 2003-11-04
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-04, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nawaprin
    Species: Naja nigricollis
    Domains in SCOP 1.73: d1udka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1udkA (A:)
    neksgscpdmsmpipplgicktlcnsdsgcpnvqkcckngcgfmtcttpvp