PDB entry 1ud1

View 1ud1 on RCSB PDB site
Description: Crystal structure of proglycinin mutant C88S
Class: plant protein
Keywords: glycinin, soybean, trimer
Deposited on 2003-04-24, released 2004-02-03
The last revision prior to the SCOP 1.75 freeze date was dated 2004-02-03, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.193
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycinin g1
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ud1a1, d1ud1a2
  • Chain 'B':
    Compound: glycinin g1
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ud1b1, d1ud1b2
  • Chain 'C':
    Compound: glycinin g1
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ud1c1, d1ud1c2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ud1A (A:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgspstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud1A (A:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiyprhqkiynfregdliavptgvawwmynnedtpvvavsiidtnsl
    enqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqgekgai
    vtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgs
    lrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaar
    sqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkfl
    vppqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ud1B (B:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgspstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud1B (B:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiyprhqkiynfregdliavptgvawwmynnedtpvvavsiidtnsl
    enqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqgekgai
    vtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgs
    lrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaar
    sqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkfl
    vppqes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ud1C (C:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgspstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud1C (C:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiyprhqkiynfregdliavptgvawwmynnedtpvvavsiidtnsl
    enqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqgekgai
    vtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgs
    lrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaar
    sqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkfl
    vppqes