PDB entry 1ucx

View 1ucx on RCSB PDB site
Description:
Deposited on 2003-04-24, released 2004-02-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.18
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ucxa1, d1ucxa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ucxb1, d1ucxb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ucxc1, d1ucxc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ucxA (A:)
    fssreqpqqnegqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucxA (A:)
    iqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngpqeiy
    iqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsiidtns
    lenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqgekga
    ivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefg
    slrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaa
    rsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkf
    lvppqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ucxB (B:)
    fssreqpqqnegqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucxB (B:)
    iqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngpqeiy
    iqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsiidtns
    lenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqgekga
    ivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefg
    slrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaa
    rsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkf
    lvppqes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ucxC (C:)
    fssreqpqqnegqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucxC (C:)
    iqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngpqeiy
    iqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsiidtns
    lenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqgekga
    ivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefg
    slrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnfvvaa
    rsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkf
    lvppqes