PDB entry 1ucb

View 1ucb on RCSB PDB site
Description: structure of uncomplexed fab compared to complex (1cly, 1clz)
Deposited on 1996-02-06, released 1997-03-12
The last revision prior to the SCOP 1.59 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucbH (H:)
    evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
    pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsva
    stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucbL (L:)
    mtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsgv
    pdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec