PDB entry 1ubz

View 1ubz on RCSB PDB site
Description:
Deposited on 2003-04-07, released 2003-04-22
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-22, with a file datestamp of 2003-04-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ubza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ubzA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrepqgirawvawrnrcqnrd
    vrqyvqgcgv