PDB entry 1ub5

View 1ub5 on RCSB PDB site
Description: Crystal structure of Antibody 19G2 with hapten at 100K
Class: immune system
Keywords: antibody fluorscence dynamics, sera ligand, IMMUNE SYSTEM
Deposited on 2003-03-30, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.248
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody 19G2, alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ub5a1, d1ub5a2
  • Chain 'B':
    Compound: antibody 19G2, beta chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UB5 (0-213)
    Domains in SCOPe 2.07: d1ub5b1, d1ub5b2
  • Chain 'H':
    Compound: antibody 19G2, alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ub5h1, d1ub5h2
  • Chain 'L':
    Compound: antibody 19G2, beta chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1UB5 (0-213)
    Domains in SCOPe 2.07: d1ub5l1, d1ub5l2
  • Heterogens: SPB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub5A (A:)
    evkllesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityyp
    dsvagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvssakttpp
    svypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsglytmsssv
    tvpsstwpstvtcsvahpassttvdkkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub5B (B:)
    divmtqaafsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnla
    sgvpnrfsssgsgtdftlrisrveaedvgvyycaqnlelpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhngytceathktstspivksf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub5H (H:)
    evkllesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityyp
    dsvagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvssakttpp
    svypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsglytmsssv
    tvpsstwpstvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ub5L (L:)
    divmtqaafsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnla
    sgvpnrfsssgsgtdftlrisrveaedvgvyycaqnlelpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhngytceathktstspivksf