PDB entry 1uad

View 1uad on RCSB PDB site
Description: Crystal structure of the RalA-GppNHp-Sec5 Ral-binding domain complex
Class: endocytosis/exocytosis
Keywords: small GTP-binding protein, immunogloblin-like fold, beta-sandwich, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2003-03-09, released 2003-07-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uada_
  • Chain 'B':
    Compound: Ras-related protein Ral-A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uadb_
  • Chain 'C':
    Compound: exocyst complex component sec5
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uadc_
  • Chain 'D':
    Compound: exocyst complex component sec5
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1uadd_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uadA (A:)
    qnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidild
    tagqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnk
    sdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uadA (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uadB (B:)
    qnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidild
    tagqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnk
    sdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uadB (B:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uadC (C:)
    msrsrqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaski
    vcrvgqakndkgdiivttksggrgtstvsfkllkpekig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uadC (C:)
    srqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivcr
    vgqakndkgdiivttksggrgtstvsfkllkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uadD (D:)
    msrsrqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaski
    vcrvgqakndkgdiivttksggrgtstvsfkllkpekig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uadD (D:)
    srqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivcr
    vgqakndkgdiivttksggrgtstvsfkllkp