PDB entry 1uac

View 1uac on RCSB PDB site
Description: Crystal Structure of HYHEL-10 FV MUTANT SFSF Complexed with TURKEY WHITE LYSOZYME
Class: immune system/hydrolase
Keywords: antigen-antibody complex, hyhel-10, mutant, anti-lysozyme antibody
Deposited on 2003-03-08, released 2004-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.149
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig VH,anti-lysozyme
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PRF 1306354A (0-112)
      • engineered (52-53)
      • engineered (57)
      • cloning artifact (113)
    Domains in SCOP 1.73: d1uach_
  • Chain 'L':
    Compound: lysozyme binding Ig kappa chain V23-J2 region
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAA38741 (0-106)
    Domains in SCOP 1.73: d1uacl_
  • Chain 'Y':
    Compound: Lysozyme C
    Species: Meleagris gallopavo
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uacy_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uacH (H:)
    dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvssfgstfyn
    pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uacL (L:)
    divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
    rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uacY (Y:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl