PDB entry 1ua2

View 1ua2 on RCSB PDB site
Description: Crystal Structure of Human CDK7
Class: cell cycle, transferase
Keywords: cell cycle; phosphorylation; protein-protein interaction; protein kinase, cell cycle, transferase
Deposited on 2004-08-11, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.217
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50613
      • modified residue (169)
    Domains in SCOPe 2.07: d1ua2a_
  • Chain 'B':
    Compound: Cell division protein kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50613
      • modified residue (169)
    Domains in SCOPe 2.07: d1ua2b_
  • Chain 'C':
    Compound: Cell division protein kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50613
      • modified residue (169)
    Domains in SCOPe 2.07: d1ua2c_
  • Chain 'D':
    Compound: Cell division protein kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50613
      • modified residue (169)
    Domains in SCOPe 2.07: d1ua2d_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ua2A (A:)
    maldvksrakryekldflgegqfatvykardkntnqivaikkiklghrseakdginrtal
    reikllqelshpniiglldafghksnislvfdfmetdleviikdnslvltpshikaymlm
    tlqgleylhqhwilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyra
    pellfgarmygvgvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdm
    cslpdyvtfksfpgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpg
    ptpgcqlprpncpvetlkeqsnpalaikrkrtealeqgglpkklif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ua2A (A:)
    ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk
    snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll
    ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila
    elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa
    gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ua2B (B:)
    maldvksrakryekldflgegqfatvykardkntnqivaikkiklghrseakdginrtal
    reikllqelshpniiglldafghksnislvfdfmetdleviikdnslvltpshikaymlm
    tlqgleylhqhwilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyra
    pellfgarmygvgvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdm
    cslpdyvtfksfpgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpg
    ptpgcqlprpncpvetlkeqsnpalaikrkrtealeqgglpkklif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ua2B (B:)
    ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk
    snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll
    ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila
    elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa
    gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ua2C (C:)
    maldvksrakryekldflgegqfatvykardkntnqivaikkiklghrseakdginrtal
    reikllqelshpniiglldafghksnislvfdfmetdleviikdnslvltpshikaymlm
    tlqgleylhqhwilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyra
    pellfgarmygvgvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdm
    cslpdyvtfksfpgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpg
    ptpgcqlprpncpvetlkeqsnpalaikrkrtealeqgglpkklif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ua2C (C:)
    ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk
    snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll
    ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila
    elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa
    gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ua2D (D:)
    maldvksrakryekldflgegqfatvykardkntnqivaikkiklghrseakdginrtal
    reikllqelshpniiglldafghksnislvfdfmetdleviikdnslvltpshikaymlm
    tlqgleylhqhwilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyra
    pellfgarmygvgvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdm
    cslpdyvtfksfpgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpg
    ptpgcqlprpncpvetlkeqsnpalaikrkrtealeqgglpkklif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ua2D (D:)
    ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk
    snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll
    ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila
    elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa
    gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn