PDB entry 1u90

View 1u90 on RCSB PDB site
Description: Crystal structures of Ral-GppNHp and Ral-GDP reveal two novel binding sites that are also present in Ras and Rap
Class: signaling protein
Keywords: Ral, GTPase, Ras, GDP, GTP, GNP, GMPPNP, GppNHp, SIGNALING PROTEIN
Deposited on 2004-08-09, released 2004-11-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: Saguinus oedipus [TaxId:9490]
    Gene: Rala, Ral-a, Ral
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1u90a_
  • Chain 'B':
    Compound: Ras-related protein Ral-A
    Species: Saguinus oedipus [TaxId:9490]
    Gene: Rala, Ral-a, Ral
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1u90b_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u90A (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u90B (B:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u90B (B:)
    alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq
    edyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdle
    dkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar