PDB entry 1u8z

View 1u8z on RCSB PDB site
Description: Crystal structures of Ral-GppNHp and Ral-GDP reveal two novel binding sites that are also present in Ras and Rap
Class: signaling protein
Keywords: Ral, GNP, GTP, GMPPNP, GppNHp, GDP, GTPase, Ras, SIGNALING PROTEIN
Deposited on 2004-08-09, released 2004-11-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.202
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: Saguinus oedipus [TaxId:9490]
    Gene: Rala, Ral-a, Ral
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1u8za_
  • Chain 'B':
    Compound: Ras-related protein Ral-A
    Species: Saguinus oedipus [TaxId:9490]
    Gene: Rala, Ral-a, Ral
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1u8zb_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8zA (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8zA (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdled
    krqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u8zB (B:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8zB (B:)
    lalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtay
    aairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdledkr
    qvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar