PDB entry 1u8y

View 1u8y on RCSB PDB site
Description: CRystal structures of Ral-GppNHp and Ral-GDP reveal two novel binding sites that are also present in Ras and Rap
Class: signaling protein
Keywords: signaling protein
Deposited on 2004-08-09, released 2004-11-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.213
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: Saguinus oedipus [TaxId:9490]
    Gene: Rala, Ral-a, Ral
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1u8ya_
  • Chain 'B':
    Compound: Ras-related protein Ral-A
    Species: Saguinus oedipus [TaxId:9490]
    Gene: Rala, Ral-a, Ral
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1u8yb_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8yA (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8yA (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyepksyrkkvvldgeevqidildtagfr
    sgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdledkrqvsveeakn
    radqwnvnyvetsaktranvdkvffdlmreirar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8yB (B:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar